SCOPe 2.08: Domain d1pzna1: 1pzn A:35-95

Lineage for d1pzna1 (1pzn A:35-95)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (4 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.4.1: DNA repair protein Rad51, N-terminal domain [47795] (1 protein)

6. Protein DNA repair protein Rad51, N-terminal domain [47796] (7 species)

7. Species Pyrococcus furiosus [TaxId:2261] [101250] (1 PDB entry)

8. Domain d1pzna1: 1pzn A:35-95 [95456]
   Other proteins in same PDB: d1pzna2, d1pznb1, d1pznc1, d1pznd1, d1pzne1, d1pznf1, d1pzng1
   disordered in the other chains of this PDB entry
   complexed with gol, imd, mpd, so4

Details for d1pzna1

PDB Entry: 1pzn, 2.85 Å

PDB Description: Rad51 (RadA)

PDB Compounds: (A:) DNA repair and recombination protein rad51

SCOPe Domain Sequences for d1pzna1:

Sequence; same for both SEQRES and ATOM records:

>d1pzna1 a.60.4.1 (A:35-95) DNA repair protein Rad51, N-terminal domain {Pyrococcus furiosus [TaxId: 2261]}
rsiedlpgvgpataeklreagydtleaiavaspielkevagisegtalkiiqaarkaanl
g

Timeline for d1pzna1:

• d1pzna1 first appeared in SCOP 1.67
  
• d1pzna1 appears in SCOPe 2.07