Lineage for d1pzna1 (1pzn A:35-95)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715792Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (4 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2715793Family a.60.4.1: DNA repair protein Rad51, N-terminal domain [47795] (1 protein)
  6. 2715794Protein DNA repair protein Rad51, N-terminal domain [47796] (7 species)
  7. 2715819Species Pyrococcus furiosus [TaxId:2261] [101250] (1 PDB entry)
  8. 2715820Domain d1pzna1: 1pzn A:35-95 [95456]
    Other proteins in same PDB: d1pzna2, d1pznb1, d1pznc1, d1pznd1, d1pzne1, d1pznf1, d1pzng1
    disordered in the other chains of this PDB entry
    complexed with gol, imd, mpd, so4

Details for d1pzna1

PDB Entry: 1pzn (more details), 2.85 Å

PDB Description: Rad51 (RadA)
PDB Compounds: (A:) DNA repair and recombination protein rad51

SCOPe Domain Sequences for d1pzna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pzna1 a.60.4.1 (A:35-95) DNA repair protein Rad51, N-terminal domain {Pyrococcus furiosus [TaxId: 2261]}
rsiedlpgvgpataeklreagydtleaiavaspielkevagisegtalkiiqaarkaanl
g

SCOPe Domain Coordinates for d1pzna1:

Click to download the PDB-style file with coordinates for d1pzna1.
(The format of our PDB-style files is described here.)

Timeline for d1pzna1: