Lineage for d1pzhc2 (1pzh C:164-332)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 420654Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 420655Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) (S)
  5. 420656Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
  6. 420663Protein Lactate dehydrogenase [56339] (13 species)
  7. 420730Species Toxoplasma gondii [TaxId:5811] [103326] (4 PDB entries)
  8. 420738Domain d1pzhc2: 1pzh C:164-332 [95438]
    Other proteins in same PDB: d1pzha1, d1pzhb1, d1pzhc1, d1pzhd1

Details for d1pzhc2

PDB Entry: 1pzh (more details), 1.9 Å

PDB Description: T.gondii LDH1 ternary complex with NAD and oxalate

SCOP Domain Sequences for d1pzhc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pzhc2 d.162.1.1 (C:164-332) Lactate dehydrogenase {Toxoplasma gondii}
acmldsgrfrryvadalsvsprdvqatvigthgdcmvplvryitvngypiqkfikdgvvt
ekqleeiaehtkvsggeivrflgqgsayyapaasavamatsflndekrvipcsvycngey
glkdmfiglpaviggagiervielelneeekkqfqksvddvmalnkavaalq

SCOP Domain Coordinates for d1pzhc2:

Click to download the PDB-style file with coordinates for d1pzhc2.
(The format of our PDB-style files is described here.)

Timeline for d1pzhc2: