Lineage for d1pzhc2 (1pzh C:164-332)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2556795Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2556796Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2556797Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2556804Protein Lactate dehydrogenase [56339] (20 species)
  7. 2557053Species Toxoplasma gondii [TaxId:5811] [103326] (5 PDB entries)
  8. 2557060Domain d1pzhc2: 1pzh C:164-332 [95438]
    Other proteins in same PDB: d1pzha1, d1pzha3, d1pzhb1, d1pzhb3, d1pzhc1, d1pzhd1
    complexed with nad, oxl

Details for d1pzhc2

PDB Entry: 1pzh (more details), 1.9 Å

PDB Description: T.gondii LDH1 ternary complex with NAD and oxalate
PDB Compounds: (C:) lactate dehydrogenase

SCOPe Domain Sequences for d1pzhc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pzhc2 d.162.1.1 (C:164-332) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]}
acmldsgrfrryvadalsvsprdvqatvigthgdcmvplvryitvngypiqkfikdgvvt
ekqleeiaehtkvsggeivrflgqgsayyapaasavamatsflndekrvipcsvycngey
glkdmfiglpaviggagiervielelneeekkqfqksvddvmalnkavaalq

SCOPe Domain Coordinates for d1pzhc2:

Click to download the PDB-style file with coordinates for d1pzhc2.
(The format of our PDB-style files is described here.)

Timeline for d1pzhc2: