Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
Protein Lactate dehydrogenase [51859] (18 species) |
Species Toxoplasma gondii [TaxId:5811] [102166] (5 PDB entries) |
Domain d1pzgc1: 1pzg C:15-163 [95429] Other proteins in same PDB: d1pzga2, d1pzga3, d1pzgb2, d1pzgb3, d1pzgc2, d1pzgd2 complexed with a3d, so4 |
PDB Entry: 1pzg (more details), 1.6 Å
SCOPe Domain Sequences for d1pzgc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pzgc1 c.2.1.5 (C:15-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} alvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvvdtn vsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnikkyc pktfiivvtnpldcmvkvmceasgvptnmicgm
Timeline for d1pzgc1: