Lineage for d1pzgb2 (1pzg B:164-333)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2604672Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2604673Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2604674Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2604681Protein Lactate dehydrogenase [56339] (20 species)
  7. 2605062Species Toxoplasma gondii [TaxId:5811] [103326] (5 PDB entries)
  8. 2605064Domain d1pzgb2: 1pzg B:164-333 [95428]
    Other proteins in same PDB: d1pzga1, d1pzga3, d1pzgb1, d1pzgb3, d1pzgc1, d1pzgd1
    complexed with a3d, so4

Details for d1pzgb2

PDB Entry: 1pzg (more details), 1.6 Å

PDB Description: T.gondii LDH1 complexed with APAD and sulfate at 1.6 Angstroms
PDB Compounds: (B:) lactate dehydrogenase

SCOPe Domain Sequences for d1pzgb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pzgb2 d.162.1.1 (B:164-333) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]}
acmldsgrfrryvadalsvsprdvqatvigthgdcmvplvryitvngypiqkfikdgvvt
ekqleeiaehtkvsggeivrflgqgsayyapaasavamatsflndekrvipcsvycngey
glkdmfiglpaviggagiervielelneeekkqfqksvddvmalnkavaalqa

SCOPe Domain Coordinates for d1pzgb2:

Click to download the PDB-style file with coordinates for d1pzgb2.
(The format of our PDB-style files is described here.)

Timeline for d1pzgb2: