Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins) |
Protein Lactate dehydrogenase [51859] (14 species) |
Species Toxoplasma gondii [TaxId:5811] [102166] (4 PDB entries) |
Domain d1pzfd1: 1pzf D:14-163 [95423] Other proteins in same PDB: d1pzfa2, d1pzfb2, d1pzfc2, d1pzfd2 complexed with a3d, oxl |
PDB Entry: 1pzf (more details), 2.2 Å
SCOP Domain Sequences for d1pzfd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pzfd1 c.2.1.5 (D:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} palvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvvdt nvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnikky cpktfiivvtnpldcmvkvmceasgvptnmicgm
Timeline for d1pzfd1: