Lineage for d1pzfc2 (1pzf C:164-332)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938734Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1938735Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1938736Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 1938743Protein Lactate dehydrogenase [56339] (18 species)
  7. 1938949Species Toxoplasma gondii [TaxId:5811] [103326] (5 PDB entries)
  8. 1938961Domain d1pzfc2: 1pzf C:164-332 [95422]
    Other proteins in same PDB: d1pzfa1, d1pzfb1, d1pzfc1, d1pzfd1
    complexed with a3d, oxl

Details for d1pzfc2

PDB Entry: 1pzf (more details), 2.2 Å

PDB Description: T.gondii LDH1 ternary complex with APAD+ and oxalate
PDB Compounds: (C:) lactate dehydrogenase

SCOPe Domain Sequences for d1pzfc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pzfc2 d.162.1.1 (C:164-332) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]}
acmldsgrfrryvadalsvsprdvqatvigthgdcmvplvryitvngypiqkfikdgvvt
ekqleeiaehtkvsggeivrflgqgsayyapaasavamatsflndekrvipcsvycngey
glkdmfiglpaviggagiervielelneeekkqfqksvddvmalnkavaalq

SCOPe Domain Coordinates for d1pzfc2:

Click to download the PDB-style file with coordinates for d1pzfc2.
(The format of our PDB-style files is described here.)

Timeline for d1pzfc2: