Lineage for d1pzfb2 (1pzf B:164-333)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2998748Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2998755Protein Lactate dehydrogenase [56339] (20 species)
  7. 2999138Species Toxoplasma gondii [TaxId:5811] [103326] (5 PDB entries)
  8. 2999149Domain d1pzfb2: 1pzf B:164-333 [95420]
    Other proteins in same PDB: d1pzfa1, d1pzfa3, d1pzfb1, d1pzfb3, d1pzfc1, d1pzfd1
    complexed with a3d, oxl

Details for d1pzfb2

PDB Entry: 1pzf (more details), 2.2 Å

PDB Description: T.gondii LDH1 ternary complex with APAD+ and oxalate
PDB Compounds: (B:) lactate dehydrogenase

SCOPe Domain Sequences for d1pzfb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pzfb2 d.162.1.1 (B:164-333) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]}
acmldsgrfrryvadalsvsprdvqatvigthgdcmvplvryitvngypiqkfikdgvvt
ekqleeiaehtkvsggeivrflgqgsayyapaasavamatsflndekrvipcsvycngey
glkdmfiglpaviggagiervielelneeekkqfqksvddvmalnkavaalqa

SCOPe Domain Coordinates for d1pzfb2:

Click to download the PDB-style file with coordinates for d1pzfb2.
(The format of our PDB-style files is described here.)

Timeline for d1pzfb2: