Lineage for d1pzea2 (1pze A:164-332)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2556795Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2556796Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2556797Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2556804Protein Lactate dehydrogenase [56339] (20 species)
  7. 2557053Species Toxoplasma gondii [TaxId:5811] [103326] (5 PDB entries)
  8. 2557062Domain d1pzea2: 1pze A:164-332 [95416]
    Other proteins in same PDB: d1pzea1

Details for d1pzea2

PDB Entry: 1pze (more details), 1.95 Å

PDB Description: T.gondii LDH1 apo form
PDB Compounds: (A:) lactate dehydrogenase

SCOPe Domain Sequences for d1pzea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pzea2 d.162.1.1 (A:164-332) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]}
acmldsgrfrryvadalsvsprdvqatvigthgdcmvplvryitvngypiqkfikdgvvt
ekqleeiaehtkvsggeivrflgqgsayyapaasavamatsflndekrvipcsvycngey
glkdmfiglpaviggagiervielelneeekkqfqksvddvmalnkavaalq

SCOPe Domain Coordinates for d1pzea2:

Click to download the PDB-style file with coordinates for d1pzea2.
(The format of our PDB-style files is described here.)

Timeline for d1pzea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pzea1