Lineage for d1pzea1 (1pze A:14-163)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2093044Family c.2.1.5: LDH N-terminal domain-like [51848] (9 protein domains)
  6. 2093083Protein Lactate dehydrogenase [51859] (18 species)
  7. 2093300Species Toxoplasma gondii [TaxId:5811] [102166] (5 PDB entries)
  8. 2093309Domain d1pzea1: 1pze A:14-163 [95415]
    Other proteins in same PDB: d1pzea2

Details for d1pzea1

PDB Entry: 1pze (more details), 1.95 Å

PDB Description: T.gondii LDH1 apo form
PDB Compounds: (A:) lactate dehydrogenase

SCOPe Domain Sequences for d1pzea1:

Sequence, based on SEQRES records: (download)

>d1pzea1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]}
palvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvvdt
nvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnikky
cpktfiivvtnpldcmvkvmceasgvptnmicgm

Sequence, based on observed residues (ATOM records): (download)

>d1pzea1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]}
palvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvvdt
nvsvraeysyeaaltgadcvivtagltkvpgsewsrndllpfnskiireigqnikkycpk
tfiivvtnpldcmvkvmceasgvptnmicgm

SCOPe Domain Coordinates for d1pzea1:

Click to download the PDB-style file with coordinates for d1pzea1.
(The format of our PDB-style files is described here.)

Timeline for d1pzea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pzea2