SCOPe 2.06: Domain d1pzda2: 1pzd A:763-874

Lineage for d1pzda2 (1pzd A:763-874)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.105: Subdomain of clathrin and coatomer appendage domain [55710] (1 superfamily)
   beta-alpha-beta-alpha-beta(4)-alpha; 3 layers: a/b/a; bifurcated antiparallel beta-sheet

4. Superfamily d.105.1: Subdomain of clathrin and coatomer appendage domain [55711] (2 families)

5. Family d.105.1.2: Coatomer appendage domain [103159] (1 protein)

6. Protein Coatomer gamma subunit, C-terminal subdomain [103160] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [103162] (1 PDB entry)

8. Domain d1pzda2: 1pzd A:763-874 [95414]
   Other proteins in same PDB: d1pzda1
   complexed with so4

Details for d1pzda2

PDB Entry: 1pzd, 2.31 Å

PDB Description: structural identification of a conserved appendage domain in the carboxyl-terminus of the copi gamma-subunit.

PDB Compounds: (A:) Coatomer gamma subunit

SCOPe Domain Sequences for d1pzda2:

Sequence; same for both SEQRES and ATOM records:

>d1pzda2 d.105.1.2 (A:763-874) Coatomer gamma subunit, C-terminal subdomain {Cow (Bos taurus) [TaxId: 9913]}
hiqkvmklnfeaawdevgdefqkeetftlstiktleeavgnivkflgmhpcersdkvpdn
knthtlllagvfrgghdilvrsrlllldtvtmqvtarsseelpvdivlasvg

Timeline for d1pzda2:

• d1pzda2 first appeared in SCOP 1.67
  
• d1pzda2 appears in SCOPe 2.05
  
• d1pzda2 appears in SCOPe 2.07
  
• d1pzda2 appears in the current release, SCOPe 2.08