Lineage for d1pzda2 (1pzd A:763-874)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 416792Fold d.105: Subdomain of clathrin and coatomer appendage domain [55710] (1 superfamily)
    beta-alpha-beta-alpha-beta(4)-alpha; 3 layers: a/b/a; bifurcated antiparallel beta-sheet
  4. 416793Superfamily d.105.1: Subdomain of clathrin and coatomer appendage domain [55711] (2 families) (S)
  5. 416809Family d.105.1.2: Coatomer appendage domain [103159] (1 protein)
  6. 416810Protein Coatomer gamma subunit, C-terminal subdomain [103160] (2 species)
  7. 416811Species Cow (Bos taurus) [TaxId:9913] [103162] (1 PDB entry)
  8. 416812Domain d1pzda2: 1pzd A:763-874 [95414]
    Other proteins in same PDB: d1pzda1
    complexed with so4

Details for d1pzda2

PDB Entry: 1pzd (more details), 2.31 Å

PDB Description: structural identification of a conserved appendage domain in the carboxyl-terminus of the copi gamma-subunit.

SCOP Domain Sequences for d1pzda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pzda2 d.105.1.2 (A:763-874) Coatomer gamma subunit, C-terminal subdomain {Cow (Bos taurus)}
hiqkvmklnfeaawdevgdefqkeetftlstiktleeavgnivkflgmhpcersdkvpdn
knthtlllagvfrgghdilvrsrlllldtvtmqvtarsseelpvdivlasvg

SCOP Domain Coordinates for d1pzda2:

Click to download the PDB-style file with coordinates for d1pzda2.
(The format of our PDB-style files is described here.)

Timeline for d1pzda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pzda1