Lineage for d1pzda1 (1pzd A:604-762)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038093Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families) (S)
    contains an additional N-terminal strand
  5. 2038145Family b.1.10.3: Coatomer appendage domain [101536] (1 protein)
  6. 2038146Protein Coatomer gamma subunit C-terminal domain, first subdomain [101537] (2 species)
  7. 2038147Species Cow (Bos taurus) [TaxId:9913] [101539] (1 PDB entry)
  8. 2038148Domain d1pzda1: 1pzd A:604-762 [95413]
    Other proteins in same PDB: d1pzda2
    complexed with so4

Details for d1pzda1

PDB Entry: 1pzd (more details), 2.31 Å

PDB Description: structural identification of a conserved appendage domain in the carboxyl-terminus of the copi gamma-subunit.
PDB Compounds: (A:) Coatomer gamma subunit

SCOPe Domain Sequences for d1pzda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pzda1 b.1.10.3 (A:604-762) Coatomer gamma subunit C-terminal domain, first subdomain {Cow (Bos taurus) [TaxId: 9913]}
kvaatrqeifqeqlaavpefqglgplfksspepvalteseteyvirctkhtftdhmvfqf
dctntlndqtlenvtvqmepseayevlcyvparslpynqpgtcytlvalpkedptavact
fscvmkftvkdcdpttgeaddegyedeyvledlevtiad

SCOPe Domain Coordinates for d1pzda1:

Click to download the PDB-style file with coordinates for d1pzda1.
(The format of our PDB-style files is described here.)

Timeline for d1pzda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pzda2