Lineage for d1pz5b2 (1pz5 B:114-213)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1760578Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)
  7. 1761437Species Mouse (Mus musculus), gamma3 [TaxId:10090] [88577] (8 PDB entries)
    Uniprot P22436 # GC3_MOUSE (P22436) Ig gamma-3 chain C region
  8. 1761438Domain d1pz5b2: 1pz5 B:114-213 [95404]
    Other proteins in same PDB: d1pz5a1, d1pz5a2, d1pz5b1
    part of Fab Sya/J6

Details for d1pz5b2

PDB Entry: 1pz5 (more details), 1.8 Å

PDB Description: Structural basis of peptide-carbohydrate mimicry in an antibody combining site
PDB Compounds: (B:) Heavy chain of Fab (SYA/J6)

SCOPe Domain Sequences for d1pz5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pz5b2 b.1.1.2 (B:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus), gamma3 [TaxId: 10090]}
atttapsvyplvpgcsdtsgssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsg
fyslsslvtvpsstwpsqtvicnvahpaskvdlikeisgp

SCOPe Domain Coordinates for d1pz5b2:

Click to download the PDB-style file with coordinates for d1pz5b2.
(The format of our PDB-style files is described here.)

Timeline for d1pz5b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pz5b1