SCOP 1.67: Domain d1pz5b2: 1pz5 B:114-213

Lineage for d1pz5b2 (1pz5 B:114-213)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus), gamma3 [TaxId:10090] [88577] (6 PDB entries)

8. Domain d1pz5b2: 1pz5 B:114-213 [95404]
   Other proteins in same PDB: d1pz5a1, d1pz5a2, d1pz5b1
   part of Fab Sya/J6

Details for d1pz5b2

PDB Entry: 1pz5, 1.8 Å

PDB Description: Structural basis of peptide-carbohydrate mimicry in an antibody combining site

SCOP Domain Sequences for d1pz5b2:

Sequence; same for both SEQRES and ATOM records:

>d1pz5b2 b.1.1.2 (B:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus), gamma3}
atttapsvyplvpgcsdtsgssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsg
fyslsslvtvpsstwpsqtvicnvahpaskvdlikeisgp

Timeline for d1pz5b2:

• d1pz5b2 is new in SCOP 1.67
  
• d1pz5b2 appears in SCOP 1.69
  
• d1pz5b2 appears in the current release, SCOPe 2.08