SCOPe 2.04: Domain d1pz5b1: 1pz5 B:1-113

Lineage for d1pz5b1 (1pz5 B:1-113)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (57 PDB entries)
   Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4

8. Domain d1pz5b1: 1pz5 B:1-113 [95403]
   Other proteins in same PDB: d1pz5a1, d1pz5a2, d1pz5b2
   part of Fab Sya/J6

Details for d1pz5b1

PDB Entry: 1pz5, 1.8 Å

PDB Description: Structural basis of peptide-carbohydrate mimicry in an antibody combining site

PDB Compounds: (B:) Heavy chain of Fab (SYA/J6)

SCOPe Domain Sequences for d1pz5b1:

Sequence; same for both SEQRES and ATOM records:

>d1pz5b1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
evkveesggglvqpggsmklscvasgftfsnywmewvrqspekglewvaeirlksnnyat
hyaesvkgrftisrddskssvylqmnnlraedtgiyyctrggavgamdywgqgtsvtvss

Timeline for d1pz5b1:

• d1pz5b1 first appeared in SCOP 1.67
  
• d1pz5b1 appears in SCOPe 2.03
  
• d1pz5b1 appears in SCOPe 2.05
  
• d1pz5b1 appears in the current release, SCOPe 2.08