SCOP 1.67: Domain d1pz5a2: 1pz5 A:108-211

Lineage for d1pz5a2 (1pz5 A:108-211)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (270 PDB entries)

8. Domain d1pz5a2: 1pz5 A:108-211 [95402]
   Other proteins in same PDB: d1pz5a1, d1pz5b1, d1pz5b2
   part of Fab Sya/J6

Details for d1pz5a2

PDB Entry: 1pz5, 1.8 Å

PDB Description: Structural basis of peptide-carbohydrate mimicry in an antibody combining site

SCOP Domain Sequences for d1pz5a2:

Sequence; same for both SEQRES and ATOM records:

>d1pz5a2 b.1.1.2 (A:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d1pz5a2:

• d1pz5a2 is new in SCOP 1.67
  
• d1pz5a2 appears in SCOP 1.69
  
• d1pz5a2 appears in the current release, SCOPe 2.08