Lineage for d1pz4a_ (1pz4 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 609048Fold d.106: Sterol carrier protein, SCP [55717] (1 superfamily)
    alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145
  4. 609049Superfamily d.106.1: Sterol carrier protein, SCP [55718] (1 family) (S)
  5. 609050Family d.106.1.1: Sterol carrier protein, SCP [55719] (3 proteins)
    Pfam 02036
  6. 609057Protein Sterol carrier protein 2 (SCP2) [55720] (3 species)
  7. 609062Species Yellow fever mosquito (Aedes aegypti) [TaxId:7159] [103163] (1 PDB entry)
  8. 609063Domain d1pz4a_: 1pz4 A: [95400]
    complexed with plm

Details for d1pz4a_

PDB Entry: 1pz4 (more details), 1.35 Å

PDB Description: The structural determination of an insect (mosquito) Sterol Carrier Protein-2 with a ligand bound C16 Fatty Acid at 1.35 A resolution

SCOP Domain Sequences for d1pz4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pz4a_ d.106.1.1 (A:) Sterol carrier protein 2 (SCP2) {Yellow fever mosquito (Aedes aegypti)}
girmslksdevfakiakrlesidpanrqvehvykfritqggkvvknwvmdlknvklvesd
daaeatltmeddimfaigtgalpakeamaqdkmevdgqvelifllepfiaslk

SCOP Domain Coordinates for d1pz4a_:

Click to download the PDB-style file with coordinates for d1pz4a_.
(The format of our PDB-style files is described here.)

Timeline for d1pz4a_: