Lineage for d1pz4a1 (1pz4 A:1-110)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968249Fold d.106: SCP-like [55717] (1 superfamily)
    alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145
  4. 2968250Superfamily d.106.1: SCP-like [55718] (5 families) (S)
  5. 2968251Family d.106.1.1: Sterol carrier protein, SCP [55719] (4 proteins)
    Pfam PF02036
  6. 2968258Protein Sterol carrier protein 2 (SCP2) [55720] (3 species)
  7. 2968263Species Yellow fever mosquito (Aedes aegypti) [TaxId:7159] [103163] (1 PDB entry)
  8. 2968264Domain d1pz4a1: 1pz4 A:1-110 [95400]
    Other proteins in same PDB: d1pz4a2
    complexed with plm

Details for d1pz4a1

PDB Entry: 1pz4 (more details), 1.35 Å

PDB Description: The structural determination of an insect (mosquito) Sterol Carrier Protein-2 with a ligand bound C16 Fatty Acid at 1.35 A resolution
PDB Compounds: (A:) Sterol carrier protein 2

SCOPe Domain Sequences for d1pz4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pz4a1 d.106.1.1 (A:1-110) Sterol carrier protein 2 (SCP2) {Yellow fever mosquito (Aedes aegypti) [TaxId: 7159]}
mslksdevfakiakrlesidpanrqvehvykfritqggkvvknwvmdlknvklvesddaa
eatltmeddimfaigtgalpakeamaqdkmevdgqvelifllepfiaslk

SCOPe Domain Coordinates for d1pz4a1:

Click to download the PDB-style file with coordinates for d1pz4a1.
(The format of our PDB-style files is described here.)

Timeline for d1pz4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pz4a2