Class b: All beta proteins [48724] (144 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (3 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins) interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain |
Protein Alpha-l-arabinofuranosidase [101924] (1 species) glycosyl hydrolase family 51 |
Species Bacillus stearothermophilus [TaxId:1422] [101925] (4 PDB entries) |
Domain d1pz3a1: 1pz3 A:5-17,A:385-501 [95396] Other proteins in same PDB: d1pz3a2, d1pz3b2 |
PDB Entry: 1pz3 (more details), 1.75 Å
SCOP Domain Sequences for d1pz3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pz3a1 b.71.1.2 (A:5-17,A:385-501) Alpha-l-arabinofuranosidase {Bacillus stearothermophilus} katmiiekdfkiaXgvalhpvisspkydskdftdvpylesiavyneekeevtifavnrdm edalllecdvrsfedyrviehivlehdnvkqtnsaqsspvvphrngdaqlsdrkvsatlp klswnvirlgk
Timeline for d1pz3a1: