SCOP 1.67: Domain d1pz2b2: 1pz2 B:18-384

Lineage for d1pz2b2 (1pz2 B:18-384)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (10 families)

5. Family c.1.8.3: beta-glycanases [51487] (22 proteins)
   consist of a number of sequence families

6. Protein Alpha-L-arabinofuranosidase, catalytic domain [102075] (1 species)
   glycosyl hydrolase family 51

7. Species Bacillus stearothermophilus [TaxId:1422] [102076] (4 PDB entries)

8. Domain d1pz2b2: 1pz2 B:18-384 [95395]
   Other proteins in same PDB: d1pz2a1, d1pz2b1
   complexed with ahr; mutant

Details for d1pz2b2

PDB Entry: 1pz2, 2 Å

PDB Description: crystal structure of a transient covalent reaction intermediate of a family 51 alpha-l-arabinofuranosidase

SCOP Domain Sequences for d1pz2b2:

Sequence; same for both SEQRES and ATOM records:

>d1pz2b2 c.1.8.3 (B:18-384) Alpha-L-arabinofuranosidase, catalytic domain {Bacillus stearothermophilus}
eidkriygsfiehlgravyggiyepghpqadengfrqdvielvkelqvpiirypggnfvs
gynwedgvgpkeqrprrldlawksvetneiglnefmdwakmvgaevnmavnlgtrgidaa
rnlveycnhpsgsyysdlriahgykephkiktwclgnamdgpwqighktaveygriacea
akvmkwvdptielvvcgssnrnmptfaeweatvldhtydhvdyislhqyygnrdndtany
lalslemddfirsvvaiadyvkakkrskktihlsfdewnvwyhsneadkliepwtvappl
lediynfedallvgcmlitlmkhadrvkiaclaqlvnviapimtekngpawkqtiyypfm
hasvygr

Timeline for d1pz2b2:

• d1pz2b2 is new in SCOP 1.67
  
• d1pz2b2 appears in SCOP 1.69
  
• d1pz2b2 appears in the current release, SCOPe 2.08