SCOPe 2.05: Domain d1pz1b_: 1pz1 B:

Lineage for d1pz1b_ (1pz1 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
   Common fold covers whole protein structure

6. Protein Putative oxidoreductase YhdN [102056] (1 species)
   General stress protein 69, GSP69, AKR11B

7. Species Bacillus subtilis [TaxId:1423] [102057] (1 PDB entry)

8. Domain d1pz1b_: 1pz1 B: [95391]
   complexed with nap

Details for d1pz1b_

PDB Entry: 1pz1, 2.2 Å

PDB Description: Structure of NADPH-dependent family 11 aldo-keto reductase AKR11B(holo)

PDB Compounds: (B:) General stress protein 69

SCOPe Domain Sequences for d1pz1b_:

Sequence; same for both SEQRES and ATOM records:

>d1pz1b_ c.1.7.1 (B:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]}
meytsiadtgieasriglgtwaiggtmwggtdektsietiraaldqgitlidtapaygfg
qseeivgkaikeymkrdqvilatktaldwknnqlfrhanrariveevenslkrlqtdyid
lyqvhwpdplvpieetaevmkelydagkiraigvsnfsieqmdtfravaplhtiqppynl
feremeesvlpyakdnkittllygslcrglltgkmteeytfegddlrnhdpkfqkprfke
ylsavnqldklaktrygksvihlavrwildqpgadialwgarkpgqlealseitgwtlns
edqkdintilentisdpvgpefmapptreeipg

Timeline for d1pz1b_:

• d1pz1b_ first appeared in SCOP 1.67
  
• d1pz1b_ appears in SCOPe 2.04
  
• d1pz1b_ is called d1pz1b1 in SCOPe 2.06
  
• d1pz1b_ appears in the current release, SCOPe 2.08, called d1pz1b1