Lineage for d1pz1b_ (1pz1 B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 384272Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family) (S)
  5. 384273Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (14 proteins)
    Common fold covers whole protein structure
  6. 384355Protein Putative oxidoreductase YhdN [102056] (1 species)
    General stress protein 69, GSP69, AKR11B
  7. 384356Species Bacillus subtilis [TaxId:1423] [102057] (1 PDB entry)
  8. 384358Domain d1pz1b_: 1pz1 B: [95391]
    complexed with nap

Details for d1pz1b_

PDB Entry: 1pz1 (more details), 2.2 Å

PDB Description: Structure of NADPH-dependent family 11 aldo-keto reductase AKR11B(holo)

SCOP Domain Sequences for d1pz1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pz1b_ c.1.7.1 (B:) Putative oxidoreductase YhdN {Bacillus subtilis}
meytsiadtgieasriglgtwaiggtmwggtdektsietiraaldqgitlidtapaygfg
qseeivgkaikeymkrdqvilatktaldwknnqlfrhanrariveevenslkrlqtdyid
lyqvhwpdplvpieetaevmkelydagkiraigvsnfsieqmdtfravaplhtiqppynl
feremeesvlpyakdnkittllygslcrglltgkmteeytfegddlrnhdpkfqkprfke
ylsavnqldklaktrygksvihlavrwildqpgadialwgarkpgqlealseitgwtlns
edqkdintilentisdpvgpefmapptreeipg

SCOP Domain Coordinates for d1pz1b_:

Click to download the PDB-style file with coordinates for d1pz1b_.
(The format of our PDB-style files is described here.)

Timeline for d1pz1b_: