Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family) |
Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (14 proteins) Common fold covers whole protein structure |
Protein Putative oxidoreductase YhdN [102056] (1 species) General stress protein 69, GSP69, AKR11B |
Species Bacillus subtilis [TaxId:1423] [102057] (1 PDB entry) |
Domain d1pz1b_: 1pz1 B: [95391] complexed with nap |
PDB Entry: 1pz1 (more details), 2.2 Å
SCOP Domain Sequences for d1pz1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pz1b_ c.1.7.1 (B:) Putative oxidoreductase YhdN {Bacillus subtilis} meytsiadtgieasriglgtwaiggtmwggtdektsietiraaldqgitlidtapaygfg qseeivgkaikeymkrdqvilatktaldwknnqlfrhanrariveevenslkrlqtdyid lyqvhwpdplvpieetaevmkelydagkiraigvsnfsieqmdtfravaplhtiqppynl feremeesvlpyakdnkittllygslcrglltgkmteeytfegddlrnhdpkfqkprfke ylsavnqldklaktrygksvihlavrwildqpgadialwgarkpgqlealseitgwtlns edqkdintilentisdpvgpefmapptreeipg
Timeline for d1pz1b_: