Lineage for d1pyya3 (1pyy A:73-263)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 515110Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
    unusual fold
  4. 515111Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (1 family) (S)
  5. 515112Family d.175.1.1: Penicillin binding protein dimerisation domain [56520] (2 proteins)
    contains an insert subdomain of ClpS-like fold
  6. 515125Protein Penicillin-binding protein 2x (pbp-2x), N-terminal domain [56521] (1 species)
    the insert subdomain (residues 93-183) is usually disordered in the structures
  7. 515126Species Streptococcus pneumoniae [TaxId:1313] [56522] (6 PDB entries)
  8. 515128Domain d1pyya3: 1pyy A:73-263 [95387]
    Other proteins in same PDB: d1pyya1, d1pyya2, d1pyya4

Details for d1pyya3

PDB Entry: 1pyy (more details), 2.42 Å

PDB Description: double mutant pbp2x t338a/m339f from streptococcus pneumoniae strain r6 at 2.4 a resolution

SCOP Domain Sequences for d1pyya3:

Sequence, based on SEQRES records: (download)

>d1pyya3 d.175.1.1 (A:73-263) Penicillin-binding protein 2x (pbp-2x), N-terminal domain {Streptococcus pneumoniae}
pakrgtiydrngvpiaedatsynvyavidenyksatgkilyvektqfnkvaevfhkyldm
eesyvreqlsqpnlkqvsfgakgngityanmmsikkeleaaevkgidfttspnrsypngq
fassfiglaqlhenedgsksllgtsgmesslnsilagtdgiityekdrlgnivpgteqvs
qrtmdgkdvyt

Sequence, based on observed residues (ATOM records): (download)

>d1pyya3 d.175.1.1 (A:73-263) Penicillin-binding protein 2x (pbp-2x), N-terminal domain {Streptococcus pneumoniae}
pakrgtiydrngvpiaedatsynvyankvaevfhkyldmeesyvreqlvsfgakgngity
anmmspnrsypngqfassfiglaqlhenedgsksllgtsgmesslnsilagtddgkdvyt

SCOP Domain Coordinates for d1pyya3:

Click to download the PDB-style file with coordinates for d1pyya3.
(The format of our PDB-style files is described here.)

Timeline for d1pyya3: