Lineage for d1pywd2 (1pyw D:122-239)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194674Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1195863Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 1195864Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (15 proteins)
  6. 1195913Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species)
  7. 1195914Species Staphylococcus aureus [TaxId:1280] [54345] (14 PDB entries)
    Uniprot P23313
  8. 1195917Domain d1pywd2: 1pyw D:122-239 [95382]
    Other proteins in same PDB: d1pywa1, d1pywa2, d1pywb1, d1pywb2, d1pywd1

Details for d1pywd2

PDB Entry: 1pyw (more details), 2.1 Å

PDB Description: human class ii mhc protein hla-dr1 bound to a designed peptide related to influenza virus hemagglutinin, fvkqna(maa)al, in complex with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)
PDB Compounds: (D:) Enterotoxin type C-3

SCOPe Domain Sequences for d1pywd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pywd2 d.15.6.1 (D:122-239) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
hfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspy
etgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng

SCOPe Domain Coordinates for d1pywd2:

Click to download the PDB-style file with coordinates for d1pywd2.
(The format of our PDB-style files is described here.)

Timeline for d1pywd2: