| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) ![]() |
| Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (14 proteins) |
| Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species) |
| Species Staphylococcus aureus [TaxId:1280] [54345] (11 PDB entries) |
| Domain d1pywd2: 1pyw D:122-239 [95382] Other proteins in same PDB: d1pywa1, d1pywa2, d1pywb1, d1pywb2, d1pywd1 complexed with ace; mutant |
PDB Entry: 1pyw (more details), 2.1 Å
SCOP Domain Sequences for d1pywd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pywd2 d.15.6.1 (D:122-239) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
hfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspy
etgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
Timeline for d1pywd2:
View in 3DDomains from other chains: (mouse over for more information) d1pywa1, d1pywa2, d1pywb1, d1pywb2 |