Lineage for d1pywd1 (1pyw D:1-121)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2049950Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2050241Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2050816Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 protein domains)
  6. 2050881Protein Staphylococcal enterotoxin C3, SEC3 [50228] (1 species)
  7. 2050882Species Staphylococcus aureus [TaxId:1280] [50229] (20 PDB entries)
    Uniprot P23313
  8. 2050885Domain d1pywd1: 1pyw D:1-121 [95381]
    Other proteins in same PDB: d1pywa1, d1pywa2, d1pywb1, d1pywb2, d1pywd2

Details for d1pywd1

PDB Entry: 1pyw (more details), 2.1 Å

PDB Description: human class ii mhc protein hla-dr1 bound to a designed peptide related to influenza virus hemagglutinin, fvkqna(maa)al, in complex with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)
PDB Compounds: (D:) Enterotoxin type C-3

SCOPe Domain Sequences for d1pywd1:

Sequence, based on SEQRES records: (download)

>d1pywd1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdsffkwdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg
n

Sequence, based on observed residues (ATOM records): (download)

>d1pywd1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdsffkwdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsggktcmyggitkhegn

SCOPe Domain Coordinates for d1pywd1:

Click to download the PDB-style file with coordinates for d1pywd1.
(The format of our PDB-style files is described here.)

Timeline for d1pywd1: