Lineage for d1pywa1 (1pyw A:82-182)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1291899Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 1291907Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (37 PDB entries)
    Uniprot P01903 28-207
    probably orthologous to the mouse I-E group
  8. 1291913Domain d1pywa1: 1pyw A:82-182 [95377]
    Other proteins in same PDB: d1pywa2, d1pywb1, d1pywb2, d1pywd1, d1pywd2

Details for d1pywa1

PDB Entry: 1pyw (more details), 2.1 Å

PDB Description: human class ii mhc protein hla-dr1 bound to a designed peptide related to influenza virus hemagglutinin, fvkqna(maa)al, in complex with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d1pywa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pywa1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefda

SCOPe Domain Coordinates for d1pywa1:

Click to download the PDB-style file with coordinates for d1pywa1.
(The format of our PDB-style files is described here.)

Timeline for d1pywa1: