Lineage for d1pywa1 (1pyw A:82-182)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 364807Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 364815Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (25 PDB entries)
    probably orthologous to the mouse I-E group
  8. 364821Domain d1pywa1: 1pyw A:82-182 [95377]
    Other proteins in same PDB: d1pywa2, d1pywb1, d1pywb2, d1pywd1, d1pywd2
    complexed with ace; mutant

Details for d1pywa1

PDB Entry: 1pyw (more details), 2.1 Å

PDB Description: human class ii mhc protein hla-dr1 bound to a designed peptide related to influenza virus hemagglutinin, fvkqna(maa)al, in complex with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)

SCOP Domain Sequences for d1pywa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pywa1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefda

SCOP Domain Coordinates for d1pywa1:

Click to download the PDB-style file with coordinates for d1pywa1.
(The format of our PDB-style files is described here.)

Timeline for d1pywa1: