SCOPe 2.07: Domain d1pyva_: 1pyv A:

Lineage for d1pyva_ (1pyv A:)

1. Root: SCOPe 2.07

2. Class j: Peptides [58231] (148 folds)

3. Fold j.36: Topogenic peptides [58555] (4 superfamilies)

4. Superfamily j.36.4: ATP synthase beta chain, mitochondrial prepeptide [103737] (1 family)

5. Family j.36.4.1: ATP synthase beta chain, mitochondrial prepeptide [103738] (1 protein)

6. Protein ATP synthase beta chain, mitochondrial prepeptide [103739] (1 species)

7. Species Leadwort-leaved tobacco (Nicotiana plumbaginifolia) [TaxId:4092] [103740] (1 PDB entry)

8. Domain d1pyva_: 1pyv A: [95376]

Details for d1pyva_

PDB Entry: 1pyv

PDB Description: nmr solution structure of the mitochondrial f1b presequence peptide from nicotiana plumbaginifolia

PDB Compounds: (A:) ATP synthase beta chain, mitochondrial precursor

SCOPe Domain Sequences for d1pyva_:

Sequence; same for both SEQRES and ATOM records:

>d1pyva_ j.36.4.1 (A:) ATP synthase beta chain, mitochondrial prepeptide {Leadwort-leaved tobacco (Nicotiana plumbaginifolia) [TaxId: 4092]}
asrrllasllrqsaqrggglisrslgnsipksasrassraspkgfllnravqy

Timeline for d1pyva_:

• d1pyva_ first appeared in SCOP 1.67
  
• d1pyva_ appears in SCOPe 2.06
  
• d1pyva_ appears in the current release, SCOPe 2.08