SCOPe 2.05: Domain d1pyu.1: 1pyu A:,B:

Lineage for d1pyu.1 (1pyu A:,B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (4 families)

5. Family b.52.2.1: Pyruvoyl dependent aspartate decarboxylase, ADC [50693] (2 proteins)

6. Protein Pyruvoyl dependent aspartate decarboxylase, ADC [50694] (2 species)
   autocatalytic enzyme

7. Species Escherichia coli [TaxId:562] [50695] (9 PDB entries)

8. Domain d1pyu.1: 1pyu A:,B: [95374]
   processed mutant
   complexed with so4; mutant

Details for d1pyu.1

PDB Entry: 1pyu, 1.9 Å

PDB Description: processed aspartate decarboxylase mutant with ser25 mutated to cys

PDB Compounds: (A:) Aspartate 1-decarboxylase beta chain, (B:) Aspartate 1-decarboxylase alfa chain

SCOPe Domain Sequences for d1pyu.1:

Sequence; same for both SEQRES and ATOM records:

>g1pyu.1 b.52.2.1 (A:,B:) Pyruvoyl dependent aspartate decarboxylase, ADC {Escherichia coli [TaxId: 562]}
prgsmirtmlqgklhrvkvthadlhyegXccaidqdfldaagileneaidiwnvtngkrf
styaiaaergsriisvngaaahcasvgdiviiasfvtmpdeeartwrpnvayfegdnemk
r

Timeline for d1pyu.1:

• d1pyu.1 first appeared in SCOP 1.67
  
• d1pyu.1 appears in SCOPe 2.04
  
• d1pyu.1 appears in SCOPe 2.06
  
• d1pyu.1 appears in the current release, SCOPe 2.08