Lineage for d1pyu.1 (1pyu A:,B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1798408Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 1798462Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 1798463Family b.52.2.1: Pyruvoyl dependent aspartate decarboxylase, ADC [50693] (2 proteins)
  6. 1798464Protein Pyruvoyl dependent aspartate decarboxylase, ADC [50694] (2 species)
    autocatalytic enzyme
  7. 1798465Species Escherichia coli [TaxId:562] [50695] (9 PDB entries)
  8. 1798476Domain d1pyu.1: 1pyu A:,B: [95374]
    processed mutant
    complexed with so4; mutant

Details for d1pyu.1

PDB Entry: 1pyu (more details), 1.9 Å

PDB Description: processed aspartate decarboxylase mutant with ser25 mutated to cys
PDB Compounds: (A:) Aspartate 1-decarboxylase beta chain, (B:) Aspartate 1-decarboxylase alfa chain

SCOPe Domain Sequences for d1pyu.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1pyu.1 b.52.2.1 (A:,B:) Pyruvoyl dependent aspartate decarboxylase, ADC {Escherichia coli [TaxId: 562]}
prgsmirtmlqgklhrvkvthadlhyegXccaidqdfldaagileneaidiwnvtngkrf
styaiaaergsriisvngaaahcasvgdiviiasfvtmpdeeartwrpnvayfegdnemk
r

SCOPe Domain Coordinates for d1pyu.1:

Click to download the PDB-style file with coordinates for d1pyu.1.
(The format of our PDB-style files is described here.)

Timeline for d1pyu.1: