![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) ![]() |
![]() | Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins) Common fold covers whole protein structure |
![]() | Protein Putative oxidoreductase IolS [102054] (1 species) vegetative protein 147, VEG147, AKR11A |
![]() | Species Bacillus subtilis [TaxId:1423] [102055] (2 PDB entries) |
![]() | Domain d1pyfa1: 1pyf A:2-310 [95334] Other proteins in same PDB: d1pyfa2 complexed with edo, na |
PDB Entry: 1pyf (more details), 1.8 Å
SCOPe Domain Sequences for d1pyfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pyfa1 c.1.7.1 (A:2-310) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} kkaklgksdlqvfpiglgtnavgghnlypnlneetgkelvreairngvtmldtayiygig rseeligevlrefnredvviatkaahrkqgndfvfdnspdflkksvdeslkrlntdyidl fyihfpdehtpkdeavnalnemkkagkirsigvsnfsleqlkeankdglvdvlqgeynll nreaektffpytkehnisfipyfplvsgllagkytedttfpegdlrneqehfkgerfken irkvnklapiaekhnvdiphivlawylarpeidilipgakradqlidniktadvtlsqed isfidklfa
Timeline for d1pyfa1: