Lineage for d1pybb_ (1pyb B:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 799407Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) (S)
  5. 799676Family b.40.4.4: Myf domain [50277] (6 proteins)
  6. 799703Protein Structure-specific tRNA-binding protein TRBP111 [89328] (2 species)
  7. 799704Species Aquifex aeolicus [TaxId:63363] [101763] (1 PDB entry)
    aq_422; putative methionyl-tRNA synthetase beta subunit
  8. 799706Domain d1pybb_: 1pyb B: [95331]

Details for d1pybb_

PDB Entry: 1pyb (more details), 2.5 Å

PDB Description: crystal structure of aquifex aeolicus trbp111: a structure-specific trna binding protein
PDB Compounds: (B:) methionyl-tRNA synthetase beta subunit

SCOP Domain Sequences for d1pybb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pybb_ b.40.4.4 (B:) Structure-specific tRNA-binding protein TRBP111 {Aquifex aeolicus [TaxId: 63363]}
aligiedflkvdlrvakvlsaervegsekllkltlslgdeertvvagiakyytpeelvgk
kivivanlkprkifgiesqgmilaasdgenlsvivpdrdvkegakls

SCOP Domain Coordinates for d1pybb_:

Click to download the PDB-style file with coordinates for d1pybb_.
(The format of our PDB-style files is described here.)

Timeline for d1pybb_: