Lineage for d1py1d_ (1py1 D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2727055Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) (S)
  5. 2727070Family a.118.9.2: VHS domain [48468] (6 proteins)
  6. 2727071Protein ADP-ribosylation factor binding protein Gga1 [74782] (1 species)
  7. 2727072Species Human (Homo sapiens) [TaxId:9606] [74783] (5 PDB entries)
  8. 2727081Domain d1py1d_: 1py1 D: [95318]
    complexed with beta-secretase C-terminal phosphopeptide

Details for d1py1d_

PDB Entry: 1py1 (more details), 2.6 Å

PDB Description: Complex of GGA1-VHS domain and beta-secretase C-terminal phosphopeptide
PDB Compounds: (D:) ADP-ribosylation factor binding protein GGA1

SCOPe Domain Sequences for d1py1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1py1d_ a.118.9.2 (D:) ADP-ribosylation factor binding protein Gga1 {Human (Homo sapiens) [TaxId: 9606]}
etlearinratnplnkeldwasingfceqlnedfegpplatrllahkiqspqeweaiqal
tvletcmkscgkrfhdevgkfrflnelikvvspkylgsrtsekvknkilellyswtvglp
eevkiaeayqmlkkqgivksdp

SCOPe Domain Coordinates for d1py1d_:

Click to download the PDB-style file with coordinates for d1py1d_.
(The format of our PDB-style files is described here.)

Timeline for d1py1d_: