SCOP 1.69: Domain d1pxxc2: 1pxx C:2033-2073

Lineage for d1pxxc2 (1pxx C:2033-2073)

1. Root: SCOP 1.69

2. Class g: Small proteins [56992] (75 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (6 families)

5. Family g.3.11.1: EGF-type module [57197] (21 proteins)

6. Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
   the rest of protein is heme-linked peroxidase, all-alpha fold

7. Species Mouse (Mus musculus) [TaxId:10090] [57212] (8 PDB entries)

8. Domain d1pxxc2: 1pxx C:2033-2073 [95312]
   Other proteins in same PDB: d1pxxa1, d1pxxb1, d1pxxc1, d1pxxd1

Details for d1pxxc2

PDB Entry: 1pxx, 2.9 Å

PDB Description: crystal structure of diclofenac bound to the cyclooxygenase active site of cox-2

SCOP Domain Sequences for d1pxxc2:

Sequence; same for both SEQRES and ATOM records:

>d1pxxc2 g.3.11.1 (C:2033-2073) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus)}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe

Timeline for d1pxxc2:

• d1pxxc2 first appeared in SCOP 1.67
  
• d1pxxc2 appears in SCOP 1.71
  
• d1pxxc2 appears in the current release, SCOPe 2.08