Lineage for d1pxwb_ (1pxw B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201108Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2201846Superfamily d.79.3: L30e-like [55315] (4 families) (S)
  5. 2201847Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)
  6. 2201864Protein Ribosomal protein L7ae [55319] (7 species)
  7. 2201937Species Pyrococcus abyssi [TaxId:29292] [103081] (2 PDB entries)
  8. 2201940Domain d1pxwb_: 1pxw B: [95306]

Details for d1pxwb_

PDB Entry: 1pxw (more details), 1.94 Å

PDB Description: crystal structure of l7ae srnp core protein from pyrococcus abyssii
PDB Compounds: (B:) LSU ribosomal protein L7AE

SCOPe Domain Sequences for d1pxwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pxwb_ d.79.3.1 (B:) Ribosomal protein L7ae {Pyrococcus abyssi [TaxId: 29292]}
psyvkfevpkelaekalqaveiardtgkirkgtnettkavergqaklviiaedvdpeeiv
ahlpplceekeipyiyvpskkelgaaagievaaasvaiiepgkardlveeiamkvrelmk

SCOPe Domain Coordinates for d1pxwb_:

Click to download the PDB-style file with coordinates for d1pxwb_.
(The format of our PDB-style files is described here.)

Timeline for d1pxwb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pxwa_