SCOPe 2.05: Domain d1pxwb_: 1pxw B:

Lineage for d1pxwb_ (1pxw B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.3: L30e-like [55315] (4 families)

5. Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)

6. Protein Ribosomal protein L7ae [55319] (7 species)

7. Species Pyrococcus abyssi [TaxId:29292] [103081] (2 PDB entries)

8. Domain d1pxwb_: 1pxw B: [95306]

Details for d1pxwb_

PDB Entry: 1pxw, 1.94 Å

PDB Description: crystal structure of l7ae srnp core protein from pyrococcus abyssii

PDB Compounds: (B:) LSU ribosomal protein L7AE

SCOPe Domain Sequences for d1pxwb_:

Sequence; same for both SEQRES and ATOM records:

>d1pxwb_ d.79.3.1 (B:) Ribosomal protein L7ae {Pyrococcus abyssi [TaxId: 29292]}
psyvkfevpkelaekalqaveiardtgkirkgtnettkavergqaklviiaedvdpeeiv
ahlpplceekeipyiyvpskkelgaaagievaaasvaiiepgkardlveeiamkvrelmk

Timeline for d1pxwb_:

• d1pxwb_ first appeared in SCOP 1.67
  
• d1pxwb_ appears in SCOPe 2.04
  
• d1pxwb_ appears in SCOPe 2.06
  
• d1pxwb_ appears in the current release, SCOPe 2.08