Lineage for d1pxwb_ (1pxw B:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 865651Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 865875Superfamily d.79.3: L30e-like [55315] (3 families) (S)
  5. 865876Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)
  6. 865893Protein Ribosomal protein L7ae [55319] (7 species)
  7. 865964Species Archaeon Pyrococcus abyssi [TaxId:29292] [103081] (2 PDB entries)
  8. 865967Domain d1pxwb_: 1pxw B: [95306]

Details for d1pxwb_

PDB Entry: 1pxw (more details), 1.94 Å

PDB Description: crystal structure of l7ae srnp core protein from pyrococcus abyssii
PDB Compounds: (B:) LSU ribosomal protein L7AE

SCOP Domain Sequences for d1pxwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pxwb_ d.79.3.1 (B:) Ribosomal protein L7ae {Archaeon Pyrococcus abyssi [TaxId: 29292]}
psyvkfevpkelaekalqaveiardtgkirkgtnettkavergqaklviiaedvdpeeiv
ahlpplceekeipyiyvpskkelgaaagievaaasvaiiepgkardlveeiamkvrelmk

SCOP Domain Coordinates for d1pxwb_:

Click to download the PDB-style file with coordinates for d1pxwb_.
(The format of our PDB-style files is described here.)

Timeline for d1pxwb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pxwa_