SCOPe 2.04: Domain d1pxvb_: 1pxv B:

Lineage for d1pxvb_ (1pxv B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein Staphopain SspB [102721] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [102722] (3 PDB entries)
   Uniprot Q70UQ9 41-393

8. Domain d1pxvb_: 1pxv B: [95302]
   Other proteins in same PDB: d1pxvc_, d1pxvd_
   complexed with staphostatin B
   complexed with gai, so4

Details for d1pxvb_

PDB Entry: 1pxv, 1.8 Å

PDB Description: the staphostatin-staphopain complex: a forward binding inhibitor in complex with its target cysteine protease

PDB Compounds: (B:) Cysteine protease

SCOPe Domain Sequences for d1pxvb_:

Sequence; same for both SEQRES and ATOM records:

>d1pxvb_ d.3.1.1 (B:) Staphopain SspB {Staphylococcus aureus [TaxId: 1280]}
ghhhhhhefdqvqyentlknfkireqqfdnswaagfsmaallnatkntdtynahdimrtl
ypevseqdlpncatfpnqmieygksqgrdihyqegvpsynqvdqltkdnvgimilaqsvs
qnpndphlghalavvgnakindqekliywnpwdtelsiqdadssllhlsfnrdynwygsm
igy

Timeline for d1pxvb_:

• d1pxvb_ first appeared in SCOP 1.67
  
• d1pxvb_ appears in SCOPe 2.03
  
• d1pxvb_ appears in SCOPe 2.05
  
• d1pxvb_ appears in the current release, SCOPe 2.08, called d1pxvb1