Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (23 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.1: Papain-like [54002] (26 proteins) |
Protein Staphopain SspB [102721] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [102722] (3 PDB entries) Uniprot Q70UQ9 41-393 |
Domain d1pxva_: 1pxv A: [95301] Other proteins in same PDB: d1pxvc_, d1pxvd_ complexed with staphostatin B complexed with gai, so4 |
PDB Entry: 1pxv (more details), 1.8 Å
SCOPe Domain Sequences for d1pxva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pxva_ d.3.1.1 (A:) Staphopain SspB {Staphylococcus aureus [TaxId: 1280]} ghhhhhhefdqvqyentlknfkireqqfdnswaagfsmaallnatkntdtynahdimrtl ypevseqdlpncatfpnqmieygksqgrdihyqegvpsynqvdqltkdnvgimilaqsvs qnpndphlghalavvgnakindqekliywnpwdtelsiqdadssllhlsfnrdynwygsm igy
Timeline for d1pxva_: