Lineage for d1pxva_ (1pxv A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1888974Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1888975Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1888976Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 1889287Protein Staphopain SspB [102721] (1 species)
  7. 1889288Species Staphylococcus aureus [TaxId:1280] [102722] (3 PDB entries)
    Uniprot Q70UQ9 41-393
  8. 1889289Domain d1pxva_: 1pxv A: [95301]
    Other proteins in same PDB: d1pxvc_, d1pxvd_
    complexed with staphostatin B
    complexed with gai, so4

Details for d1pxva_

PDB Entry: 1pxv (more details), 1.8 Å

PDB Description: the staphostatin-staphopain complex: a forward binding inhibitor in complex with its target cysteine protease
PDB Compounds: (A:) Cysteine protease

SCOPe Domain Sequences for d1pxva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pxva_ d.3.1.1 (A:) Staphopain SspB {Staphylococcus aureus [TaxId: 1280]}
ghhhhhhefdqvqyentlknfkireqqfdnswaagfsmaallnatkntdtynahdimrtl
ypevseqdlpncatfpnqmieygksqgrdihyqegvpsynqvdqltkdnvgimilaqsvs
qnpndphlghalavvgnakindqekliywnpwdtelsiqdadssllhlsfnrdynwygsm
igy

SCOPe Domain Coordinates for d1pxva_:

Click to download the PDB-style file with coordinates for d1pxva_.
(The format of our PDB-style files is described here.)

Timeline for d1pxva_: