SCOP 1.71: Domain d1pxva_: 1pxv A:

Lineage for d1pxva_ (1pxv A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (12 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (23 proteins)

6. Protein Staphopain SspB [102721] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [102722] (2 PDB entries)

8. Domain d1pxva_: 1pxv A: [95301]
   Other proteins in same PDB: d1pxvc_, d1pxvd_

Details for d1pxva_

PDB Entry: 1pxv, 1.8 Å

PDB Description: the staphostatin-staphopain complex: a forward binding inhibitor in complex with its target cysteine protease

SCOP Domain Sequences for d1pxva_:

Sequence; same for both SEQRES and ATOM records:

>d1pxva_ d.3.1.1 (A:) Staphopain SspB {Staphylococcus aureus}
ghhhhhhefdqvqyentlknfkireqqfdnswaagfsmaallnatkntdtynahdimrtl
ypevseqdlpncatfpnqmieygksqgrdihyqegvpsynqvdqltkdnvgimilaqsvs
qnpndphlghalavvgnakindqekliywnpwdtelsiqdadssllhlsfnrdynwygsm
igy

Timeline for d1pxva_:

• d1pxva_ first appeared in SCOP 1.67
  
• d1pxva_ appears in SCOP 1.69
  
• d1pxva_ appears in SCOP 1.73
  
• d1pxva_ appears in the current release, SCOPe 2.08, called d1pxva1