Lineage for d1pxea_ (1pxe A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038623Fold g.73: CCHHC domain [103636] (1 superfamily)
    metal(zinc)-bound fold
  4. 3038624Superfamily g.73.1: CCHHC domain [103637] (1 family) (S)
  5. 3038625Family g.73.1.1: CCHHC domain [103638] (1 protein)
  6. 3038626Protein Neural zinc finger transcription factor 1 [103639] (1 species)
  7. 3038627Species Norway rat (Rattus norvegicus) [TaxId:10116] [103640] (1 PDB entry)
  8. 3038628Domain d1pxea_: 1pxe A: [95286]
    complexed with zn

Details for d1pxea_

PDB Entry: 1pxe (more details)

PDB Description: solution structure of a cchhc domain of neural zinc finger factor-1
PDB Compounds: (A:) neural zinc finger transcription factor 1

SCOPe Domain Sequences for d1pxea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pxea_ g.73.1.1 (A:) Neural zinc finger transcription factor 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
reskcptpgcdgtghvtglyphhrslsgcphkdrvppeilamhenvlk

SCOPe Domain Coordinates for d1pxea_:

Click to download the PDB-style file with coordinates for d1pxea_.
(The format of our PDB-style files is described here.)

Timeline for d1pxea_: