Lineage for d1px5a2 (1px5 A:1-200)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 422922Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 422923Superfamily d.218.1: Nucleotidyltransferase [81301] (8 families) (S)
  5. 423089Family d.218.1.6: 2'-5'-oligoadenylate synthetase 1, OAS1, N-terminal domain [102937] (1 protein)
    similar overall structure to the first two domains of poly(A) polymerase, PAP
  6. 423090Protein 2'-5'-oligoadenylate synthetase 1, OAS1, N-terminal domain [102938] (1 species)
  7. 423091Species Pig (Sus scrofa) [TaxId:9823] [102939] (1 PDB entry)
  8. 423092Domain d1px5a2: 1px5 A:1-200 [95278]
    Other proteins in same PDB: d1px5a1, d1px5b1

Details for d1px5a2

PDB Entry: 1px5 (more details), 1.74 Å

PDB Description: Crystal structure of the 2'-specific and double-stranded RNA-activated interferon-induced antiviral protein 2'-5'-oligoadenylate synthetase

SCOP Domain Sequences for d1px5a2:

Sequence, based on SEQRES records: (download)

>d1px5a2 d.218.1.6 (A:1-200) 2'-5'-oligoadenylate synthetase 1, OAS1, N-terminal domain {Pig (Sus scrofa)}
melrhtpardldkfiedhllpntcfrtqvkeaidivcrflkercfqgtadpvrvskvvkg
gssgkgttlrgrsdadlvvfltkltsfedqlrrrgefiqeirrqleacqreqkfkvtfev
qsprrenpralsfvlsspqlqqevefdvlpafdalgqwtpgykpnpeiyvqlikecksrg
kegefstcftelqrdflrnr

Sequence, based on observed residues (ATOM records): (download)

>d1px5a2 d.218.1.6 (A:1-200) 2'-5'-oligoadenylate synthetase 1, OAS1, N-terminal domain {Pig (Sus scrofa)}
melrhtpardldkfiedhllpntcfrtqvkeaidivcrflkercfqgpvrvskvvkggss
rsdadlvvfltkltsfedqlrrrgefiqeirrqleacqreqkfkvtfevqspalsfvlss
pqlqqevefdvlpafdalgqwtpgykpnpeiyvqlikecksrgkegefstcftelqrdfl
rnr

SCOP Domain Coordinates for d1px5a2:

Click to download the PDB-style file with coordinates for d1px5a2.
(The format of our PDB-style files is described here.)

Timeline for d1px5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1px5a1