![]() | Class a: All alpha proteins [46456] (218 folds) |
![]() | Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily) core: 5-helical bundle; up-and-down; right-handed twist |
![]() | Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (3 families) ![]() this domain follows the catalytic nucleotidyltransferase domain |
![]() | Family a.160.1.2: 2'-5'-oligoadenylate synthetase 1, OAS1, second domain [101271] (1 protein) |
![]() | Protein 2'-5'-oligoadenylate synthetase 1, OAS1, second domain [101272] (1 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [101273] (1 PDB entry) |
![]() | Domain d1px5a1: 1px5 A:201-346 [95277] Other proteins in same PDB: d1px5a2, d1px5b2 |
PDB Entry: 1px5 (more details), 1.74 Å
SCOP Domain Sequences for d1px5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1px5a1 a.160.1.2 (A:201-346) 2'-5'-oligoadenylate synthetase 1, OAS1, second domain {Pig (Sus scrofa)} ptklkslirlvkhwyqtckkthgnklppqyalelltvyaweqgsrktdfstaqgfqtvle lvlkhqklcifweayydftnpvvgrcmlqqlkkprpvildpadptgnvgggdthswqrla qearvwlgypccknldgslvgawtml
Timeline for d1px5a1: