SCOPe 2.03: Domain d1px2b1: 1px2 B:113-213

Lineage for d1px2b1 (1px2 B:113-213)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (9 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.5: Synapsin domain [52463] (2 proteins)
   automatically mapped to Pfam PF02078

6. Protein Synapsin I [52464] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [102287] (2 PDB entries)

8. Domain d1px2b1: 1px2 B:113-213 [95275]
   Other proteins in same PDB: d1px2a2, d1px2b2
   complexed with atp, ca

Details for d1px2b1

PDB Entry: 1px2, 2.23 Å

PDB Description: Crystal Structure of Rat Synapsin I C Domain Complexed to Ca.ATP (Form 1)

PDB Compounds: (B:) Synapsin I

SCOPe Domain Sequences for d1px2b1:

Sequence; same for both SEQRES and ATOM records:

>d1px2b1 c.30.1.5 (B:113-213) Synapsin I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
arvllvidephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevlrngv
kvvrslkpdfvlirqhafsmarngdyrslviglqyagipsv

Timeline for d1px2b1:

• d1px2b1 first appeared in SCOP 1.67
  
• d1px2b1 appears in SCOPe 2.02
  
• d1px2b1 appears in SCOPe 2.04
  
• d1px2b1 appears in the current release, SCOPe 2.08