Lineage for d1px2b1 (1px2 B:113-213)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2861871Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2861872Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2862087Family c.30.1.5: Synapsin domain [52463] (2 proteins)
    automatically mapped to Pfam PF02078
  6. 2862088Protein Synapsin I [52464] (2 species)
  7. 2862094Species Norway rat (Rattus norvegicus) [TaxId:10116] [102287] (2 PDB entries)
  8. 2862104Domain d1px2b1: 1px2 B:113-213 [95275]
    Other proteins in same PDB: d1px2a2, d1px2b2
    complexed with atp, ca

Details for d1px2b1

PDB Entry: 1px2 (more details), 2.23 Å

PDB Description: Crystal Structure of Rat Synapsin I C Domain Complexed to Ca.ATP (Form 1)
PDB Compounds: (B:) Synapsin I

SCOPe Domain Sequences for d1px2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1px2b1 c.30.1.5 (B:113-213) Synapsin I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
arvllvidephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevlrngv
kvvrslkpdfvlirqhafsmarngdyrslviglqyagipsv

SCOPe Domain Coordinates for d1px2b1:

Click to download the PDB-style file with coordinates for d1px2b1.
(The format of our PDB-style files is described here.)

Timeline for d1px2b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1px2b2