SCOP 1.75: Domain d1pwxc_: 1pwx C:

Lineage for d1pwxc_ (1pwx C:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein Halohydrin dehalogenase HheC [102153] (1 species)
   haloalcohol dehalogenase: evolved a new activity; lost the NAD-binding site

7. Species Agrobacterium tumefaciens [TaxId:358] [102154] (5 PDB entries)

8. Domain d1pwxc_: 1pwx C: [95264]

Details for d1pwxc_

PDB Entry: 1pwx, 1.8 Å

PDB Description: Crystal structure of the haloalcohol dehalogenase HheC complexed with bromide

PDB Compounds: (C:) halohydrin dehalogenase

SCOP Domain Sequences for d1pwxc_:

Sequence; same for both SEQRES and ATOM records:

>d1pwxc_ c.2.1.2 (C:) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]}
staivtnvkhfggmgsalrlseaghtvachdesfkqkdeleafaetypqlkpmseqepae
lieavtsaygqvdvlvsndifapefqpidkyavedyrgavealqirpfalvnavasqmkk
rksghiifitsatpfgpwkelstytsaragactlanalskelgeynipvfaigpnylhse
dspyfyptepwktnpehvahvkkvtalqrlgtqkelgelvaflasgscdyltgqvfwlag
gfpmierwpgmp

Timeline for d1pwxc_:

• d1pwxc_ first appeared in SCOP 1.67
  
• d1pwxc_ appears in SCOP 1.73
  
• d1pwxc_ appears in SCOPe 2.01
  
• d1pwxc_ appears in the current release, SCOPe 2.08