Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
Superfamily d.166.1: ADP-ribosylation [56399] (8 families) |
Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins) |
Protein Anthrax toxin lethal factor, middle domain [69845] (1 species) includes an all-alpha insert subdomain |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [69846] (9 PDB entries) |
Domain d1pwwa3: 1pww A:264-550 [95258] Other proteins in same PDB: d1pwwa1, d1pwwa2, d1pwwb1, d1pwwb2 complexed with an optimized peptide substrate (chains C and D) in the presence of zinc complexed with zn; mutant |
PDB Entry: 1pww (more details), 2.8 Å
SCOPe Domain Sequences for d1pwwa3:
Sequence, based on SEQRES records: (download)
>d1pwwa3 d.166.1.1 (A:264-550) Anthrax toxin lethal factor, middle domain {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} mlsryekwekikqhyqhwsdslseegrgllkklqipiepkkddiihslsqeekellkriq idssdflsteekeflkklqidirdslseeekellnriqvdssnplsekekeflkklkldi qpydinqrlqdtgglidspsinldvrkqykrdiqnidallhqsigstlynkiylyenmni nnltatlgadlvdstdntkinrgifnefkknfkysissnymivdinerpaldnerlkwri qlspdtragylengklilqrnigleikdvqiikqsekeyiridakvv
>d1pwwa3 d.166.1.1 (A:264-550) Anthrax toxin lethal factor, middle domain {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} mlsryekwekikqhyqhwsdslseegrgllkklqipiepkkddiihslsqeekellkriq idssdflsteekeflkklqidilsekekeflkklkldiqpydinqrlqdtgglidspsin ldvrkqykrdiqnidallhqsigstlynkiylyenmninnltatlgadlvdstdntkinr gifnefkknfkysissnymivdinerpaldnerlkwriqlspdtragylengklilqrni gleikdvqiikqsekeyiridakvv
Timeline for d1pwwa3: