SCOPe 2.01: Domain d1pwwa2: 1pww A:551-776

Lineage for d1pwwa2 (1pww A:551-776)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.14: Anthrax toxin lethal factor, N- and C-terminal domains [69775] (1 protein)

6. Protein Anthrax toxin lethal factor, N- and C-terminal domains [69776] (1 species)
   duplication: each domain adopts a thermolysin-like fold, but the proteolytic activity resides only in the C-terminal domain

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [69777] (9 PDB entries)

8. Domain d1pwwa2: 1pww A:551-776 [95257]
   Other proteins in same PDB: d1pwwa3, d1pwwb3
   complexed with an optimized peptide substrate (chains C and D) in the presence of zinc
   complexed with zn; mutant

Details for d1pwwa2

PDB Entry: 1pww, 2.8 Å

PDB Description: crystal structure of anthrax lethal factor active site mutant protein complexed with an optimised peptide substrate in the presence of zinc.

PDB Compounds: (A:) Lethal Factor

SCOPe Domain Sequences for d1pwwa2:

Sequence; same for both SEQRES and ATOM records:

>d1pwwa2 d.92.1.14 (A:551-776) Anthrax toxin lethal factor, N- and C-terminal domains {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
pkskidtkiqeaqlninqewnkalglpkytklitfnvhnryasnivesaylilnewknni
qsdlikkvtnylvdgngrfvftditlpniaeqythqdeiyeqvhskglyvpesrsillhg
pskgvelrndsegfihcfghavddyagylldknqsdlvtnskkfidifkeegsnltsygr
tneaeffaeafrlmhstdhaerlkvqknapktfqfindqikfiins

Timeline for d1pwwa2:

• d1pwwa2 first appeared in SCOP 1.67
  
• d1pwwa2 appears in SCOP 1.75
  
• d1pwwa2 appears in SCOPe 2.02
  
• d1pwwa2 appears in the current release, SCOPe 2.08