SCOP 1.67: Domain d1pwva1: 1pwv A:27-263

Lineage for d1pwva1 (1pwv A:27-263)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families)

5. Family d.92.1.14: Anthrax toxin lethal factor, N- and C-terminal domains [69775] (1 protein)

6. Protein Anthrax toxin lethal factor, N- and C-terminal domains [69776] (1 species)
   duplication: each domain adopts a thermolysin-like fold, but the proteolytic activity resides only in the C-terminal domain

7. Species Bacillus anthracis [TaxId:1392] [69777] (7 PDB entries)

8. Domain d1pwva1: 1pwv A:27-263 [95250]
   Other proteins in same PDB: d1pwva3, d1pwvb3

Details for d1pwva1

PDB Entry: 1pwv, 2.85 Å

PDB Description: Crystal structure of Anthrax Lethal Factor wild-type protein complexed with an optimised peptide substrate.

SCOP Domain Sequences for d1pwva1:

Sequence; same for both SEQRES and ATOM records:

>d1pwva1 d.92.1.14 (A:27-263) Anthrax toxin lethal factor, N- and C-terminal domains {Bacillus anthracis}
ernktqeehlkeimkhivkievkgeeavkkeaaekllekvpsdvlemykaiggkiyivdg
ditkhislealsedkkkikdiygkdallhehyvyakegyepvlviqssedyventekaln
vyyeigkilsrdilskinqpyqkfldvlntiknasdsdgqdllftnqlkehptdfsvefl
eqnsnevqevfakafayyiepqhrdvlqlyapeafnymdkfneqeinlsleelkdqr

Timeline for d1pwva1:

• d1pwva1 is new in SCOP 1.67
  
• d1pwva1 appears in SCOP 1.69
  
• d1pwva1 appears in the current release, SCOPe 2.08